Anti-Granzyme B (C11, CTLA-1, Cathepsin G-like 1, CTSGL1, Cytotoxic T-lymphocyte Proteinase 2, Lymph

Anti-Granzyme B (C11, CTLA-1, Cathepsin G-like 1, CTSGL1, Cytotoxic T-lymphocyte Proteinase 2, Lymph
Item number Size Datasheet Manual SDS Delivery time Quantity Price
127521.100 100 µg - -

3 - 19 business days*

715.00€
 
Granzyme A and granzyme B are serine proteases that mediate apoptotic signaling in cytotoxic T... more
Product information "Anti-Granzyme B (C11, CTLA-1, Cathepsin G-like 1, CTSGL1, Cytotoxic T-lymphocyte Proteinase 2, Lymph"
Granzyme A and granzyme B are serine proteases that mediate apoptotic signaling in cytotoxic T lymphocytes (CTL) and in natural killer (NK) cells. Both granzyme A and granzyme B are synthesized as inactive proenzymes that are stored within cytolytic granules and released by effector cells during degradation. Granzyme B should be useful for localization of granzyme B-containing lytic granules and characterization of activated CTLs or NK cells. Applications: Suitable for use in ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: GQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHYYDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWIKKTMKRH, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 127521

Properties

Application: ELISA, IP, WB
Antibody Type: Monoclonal
Clone: 4F5
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Partial recombinant corresponding to aa148-247 from human GZMB (AAH30195) with GST tag. MW of the GST tag alone is 26kD.
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Granzyme B (C11, CTLA-1, Cathepsin G-like 1, CTSGL1, Cytotoxic T-lymphocyte Proteinase 2, Lymph"
Write a review
or to review a product.
Viewed