Anti-GNAZ

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG58934.50 50 µl - -

6 - 14 business days*

584.00€
 
Protein function: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or... more
Product information "Anti-GNAZ"
Protein function: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. [The UniProt Consortium]
Keywords: Anti-GNAZ, Anti-Gz-alpha, Anti-G(x) alpha chain, Anti-Guanine nucleotide-binding protein G(z) subunit alpha
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG58934

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human (Expected: mouse, rat, bovine, dog, guinea pig, horse, rabbit)
Immunogen: Synthetic peptide around the N-terminal region of Human GNAZ. (within the following region: LIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEIT)
MW: 40 kD
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GNAZ"
Write a review
or to review a product.
Viewed