Anti-GNAZ

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG58934.50	50 µl		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or... more

Close menu

Product information "Anti-GNAZ"

Protein function: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. [The UniProt Consortium]

Keywords:	Anti-GNAZ, Anti-Gz-alpha, Anti-G(x) alpha chain, Anti-Guanine nucleotide-binding protein G(z) subunit alpha
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG58934

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human (Expected: mouse, rat, bovine, dog, guinea pig, horse, rabbit)
Immunogen:	Synthetic peptide around the N-terminal region of Human GNAZ. (within the following region: LIIYNAIDSLTRIIRALAALRIDFHNPDRAYDAVQLFALTGPAESKGEIT)
MW:	40 kD
Format:	Affinity Purified