Anti-GNAQ / Guanine nucleotide binding protein Gq subunit alpha, clone 13H4

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-FY13427 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. GNAQ Antibody targets Guanine nucleotide... more
Product information "Anti-GNAQ / Guanine nucleotide binding protein Gq subunit alpha, clone 13H4"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. GNAQ Antibody targets Guanine nucleotide binding protein Gq subunit alpha, a heterotrimeric G protein alpha subunit encoded by the GNAQ gene. GNAQ is a member of the Gq family of G proteins that couple activated G protein-coupled receptors to downstream intracellular signaling pathways. Upon receptor stimulation, GNAQ exchanges GDP for GTP and dissociates from the beta-gamma complex, allowing it to activate effector enzymes that regulate second messenger production. This signaling mechanism plays a central role in transducing extracellular cues into coordinated cellular responses.Guanine nucleotide binding protein Gq subunit alpha primarily functions by activating phospholipase C beta isoforms. Activation of phospholipase C beta leads to hydrolysis of phosphatidylinositol 4,5-bisphosphate, generating inositol 1,4,5-trisphosphate and diacylglycerol. These second messengers promote intracellular calcium release and activation of protein kinase C, respectively. Through this pathway, GNAQ influences diverse biological processes including cell proliferation, differentiation, secretion, and cytoskeletal dynamics. A short functional summary is that GNAQ serves as a molecular switch linking receptor activation to calcium-dependent and protein kinase C-mediated signaling cascades.GNAQ is broadly expressed across many tissues and cell types, reflecting its involvement in multiple physiological systems. It is found in epithelial cells, endothelial cells, immune cells, and neurons, with localization predominantly at the cytoplasmic face of the plasma membrane where G protein-coupled receptors reside. Expression and activity of GNAQ are dynamically regulated in response to extracellular ligands such as hormones, neurotransmitters, and growth factors, enabling precise control of signal amplitude and duration.From a disease relevance perspective, dysregulation of GNAQ signaling has been associated with several pathological conditions. Somatic activating mutations in GNAQ have been identified in uveal melanoma and other vascular and melanocytic disorders, where constitutive activation of downstream signaling promotes abnormal cell growth and survival. Altered GNAQ-mediated signaling has also been examined in cardiovascular disease, inflammatory responses, and neurological signaling pathways. These findings underscore the importance of tightly regulated GNAQ activity for maintaining cellular homeostasis.A GNAQ Antibody is a useful research tool for detecting guanine nucleotide binding protein Gq subunit alpha expression and studying its regulation in cellular and tissue-based systems. Detection of GNAQ supports investigations into G protein-coupled receptor signaling, calcium-mediated signal transduction, and disease-associated alterations in Gq pathway activity. This antibody targets guanine nucleotide binding protein Gq subunit alpha for use in research applications focused on signal transduction and cell communication biology.
Keywords: Anti-GNAQ, Anti-Guanine nucleotide-binding protein alpha-q, Anti-Guanine nucleotide-binding protein G(q) subunit alpha, GNAQ Antibody / Guanine nucleotide binding protein Gq subunit alpha
Supplier: NSJ Bioreagents
Supplier-Nr: FY13427

Properties

Application: WB, IHC (paraffin), FC
Antibody Type: Monoclonal
Clone: 13H4
Conjugate: No
Host: Mouse
Species reactivity: human, mouse, rat, monkey
Immunogen: Amino acids KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GNAQ / Guanine nucleotide binding protein Gq subunit alpha, clone 13H4"
Write a review
or to review a product.
Viewed