Anti-GAA / Glucosidase alpha acid, clone 2G7

Anti-GAA / Glucosidase alpha acid, clone 2G7
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ6025 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Lysosomal alpha-glucosidase is an enzyme... more
Product information "Anti-GAA / Glucosidase alpha acid, clone 2G7"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Lysosomal alpha-glucosidase is an enzyme that in humans is encoded by the GAA gene. This gene encodes lysosomal alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. The encoded preproprotein is proteolytically processed to generate multiple intermediate forms and the mature form of the enzyme. Defects in this gene are the cause of glycogen storage disease II, also known as Pompe's disease, which is an autosomal recessive disorder with a broad clinical spectrum. Alternative splicing results in multiple transcript variants. Protein function: Essential for the degradation of glycogen in lysosomes (PubMed:14695532, PubMed:18429042, PubMed:1856189, PubMed:7717400). Has highest activity on alpha-1,4-linked glycosidic linkages, but can also hydrolyze alpha-1,6-linked glucans (PubMed:29061980). [The UniProt Consortium]
Keywords: Anti-GAA, GAA Antibody / Glucosidase alpha acid
Supplier: NSJ Bioreagents
Supplier-Nr: RQ6025

Properties

Application: WB, IHC (paraffin), IF
Antibody Type: Monoclonal
Clone: 2G7
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Amino acids TALAWWEDMVAEFHDQVPFDGMWIDMNEPSNFIR from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-GAA / Glucosidase alpha acid, clone 2G7"
Write a review
or to review a product.
Viewed