Anti-FMO2

Anti-FMO2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG58712.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Catalyzes the N-oxidation of certain primary alkylamines to their oximes via an... more
Product information "Anti-FMO2"
Protein function: Catalyzes the N-oxidation of certain primary alkylamines to their oximes via an N-hydroxylamine intermediate. Inactive toward certain tertiary amines, such as imipramine or chloropromazine. Can catalyze the S-oxidation of methimazole. [The UniProt Consortium]
Keywords: Anti-FMO2, Anti-FMO 2, Anti-FMO 1B1, EC=1.14.13.8, Anti-Dimethylaniline oxidase 2, Anti-Pulmonary flavin-containing monooxygenase 2, Anti-Dimethylaniline monooxygenase [N-oxide-forming] 2
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG58712

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Synthetic peptide corresponding to aa. 78-115 of Human FMO2 (FPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRK)
MW: 54 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-FMO2"
Write a review
or to review a product.
Viewed