Anti-FMO2

Anti-FMO2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32311 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Dimethylaniline monooxygenase... more
Product information "Anti-FMO2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Dimethylaniline monooxygenase [N-oxide-forming] 2 is an enzyme that in humans is encoded by the FMO2 gene (flavin containing monooxygenase 2). It is an NADPH-dependent enzyme that catalyzes the N-oxidation of some primary alkylamines through an N-hydroxylamine intermediate. However, some human populations contain an allele (FMO2*2A) with a premature stop codon, resulting in a protein that is C-terminally-truncated, has no catalytic activity, and is likely degraded rapidly. This gene is found in a cluster with other related family members on chromosome 1. Alternative splicing results in multiple transcript variants. Protein function: Catalyzes the N-oxidation of certain primary alkylamines to their oximes via an N-hydroxylamine intermediate. Inactive toward certain tertiary amines, such as imipramine or chloropromazine. Can catalyze the S-oxidation of methimazole. The truncated form is catalytically inactive. [The UniProt Consortium]
Keywords: Anti-FMO2, Anti-FMO 2, Anti-FMO 1B1, EC=1.14.13.8, Anti-Dimethylaniline oxidase 2, Anti-Pulmonary flavin-containing monooxygenase 2, Anti-Dimethylaniline monooxygenase [N-oxide-forming] 2, FMO2 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32311

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Amino acids FPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVLSVRK of human FMO2 were used as the immunogen for the FMO2 antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-FMO2"
Write a review
or to review a product.
Viewed