Anti-FBXW7 (F-Box And WD Repeat Domain Containing 7, AGO, CDC4, DKFZp686F23254, FBW6, FBW7, FBX30, F

Anti-FBXW7 (F-Box And WD Repeat Domain Containing 7, AGO, CDC4, DKFZp686F23254, FBW6, FBW7, FBX30, F
Item number Size Datasheet Manual SDS Delivery time Quantity Price
126716.100 100 µg - -

3 - 19 business days*

744.00€
 
The F-box protein family is characterized by an approximately 40aa motif, the F-box. F-box... more
Product information "Anti-FBXW7 (F-Box And WD Repeat Domain Containing 7, AGO, CDC4, DKFZp686F23254, FBW6, FBW7, FBX30, F"
The F-box protein family is characterized by an approximately 40aa motif, the F-box. F-box proteins are divided into 3 classes: FBWs containing WD-40 domains, FBLs containing leucine-rich repeats, and FBXs containing either different protein-protein interaction modules or no recognizable motifs. They constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. Cdc4 is one member of this family, which is also known as AGO, FBW7, FBX30 or SEL10. CDC4 binds directly to cyclin E and targets cyclin E for ubiquitin-mediated degradation. Cdc4 proteins of amino acid lengths varying from 553aa to 707aa in length have been reported. Cdc4 is an inhibitor of Notch signaling that targets Notch for ubiquitin-mediated degradation after a nuclear phosphorylation event. Cdc4 interacts with presenilin 1, facilitates its ubiquitination, and alters A-beta peptide production. Thus, it may be important for Alzheimer's disease. Mutations of the CDC4 gene are detected in ovarian and breast cancer cell lines and the CDC4 gene may also be involved in the pathogenesis of human pancreatic and endometrial cancers. Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MCVPRSGLILSCICLYCGVLLPVLLPNLPFLTCLSMSTLESVTYLPEKGLYCQRLPSSRTHGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 126716

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human
Immunogen: Full length human FBXW7, aa1-627 (NP_060785.2).
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-FBXW7 (F-Box And WD Repeat Domain Containing 7, AGO, CDC4, DKFZp686F23254, FBW6, FBW7, FBX30, F"
Write a review
or to review a product.
Viewed