Anti-FBXL11

Anti-FBXL11
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59309.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Histone demethylase that specifically demethylates 'Lys- 36' of histone H3,... more
Product information "Anti-FBXL11"
Protein function: Histone demethylase that specifically demethylates 'Lys- 36' of histone H3, thereby playing a central role in histone code. Preferentially demethylates dimethylated H3 'Lys-36' residue while it has weak or no activity for mono- and tri-methylated H3 'Lys- 36'. May also recognize and bind to some phosphorylated proteins and promote their ubiquitination and degradation. Required to maintain the heterochromatic state. Associates with centromeres and represses transcription of small non-coding RNAs that are encoded by the clusters of satellite repeats at the centromere. Required to sustain centromeric integrity and genomic stability, particularly during mitosis. Regulates circadian gene expression by repressing the transcriptional activator activity of CLOCK- ARNTL/BMAL1 heterodimer and RORA in a catalytically-independent manner (PubMed:26037310). [The UniProt Consortium]
Keywords: Anti-KDM2A, Anti-CXXC8, Anti-F-box protein FBL7, Anti-F-box protein Lilina, Anti-F-box/LRR-repeat protein 11, Anti-Lysine-specific demethylase 2A, Anti-CXXC-type zinc finger protein 8, Anti-[Histone-H3]-lysine-36 demethylase 1A
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59309

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse (Expected: rat)
Immunogen: Synthetic peptide corresponding to a sequence of Human FBXL11. (KRTFDLEEKLHTNKYNANFVTFMEGKDFNVEYIQR)
MW: 133 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-FBXL11"
Write a review
or to review a product.
Viewed