Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| ARG59309.50 | 50 µg | - | - |
6 - 14 business days* |
551.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Protein function: Histone demethylase that specifically demethylates 'Lys- 36' of histone H3,... more
Product information "Anti-FBXL11"
Protein function: Histone demethylase that specifically demethylates 'Lys- 36' of histone H3, thereby playing a central role in histone code. Preferentially demethylates dimethylated H3 'Lys-36' residue while it has weak or no activity for mono- and tri-methylated H3 'Lys- 36'. May also recognize and bind to some phosphorylated proteins and promote their ubiquitination and degradation. Required to maintain the heterochromatic state. Associates with centromeres and represses transcription of small non-coding RNAs that are encoded by the clusters of satellite repeats at the centromere. Required to sustain centromeric integrity and genomic stability, particularly during mitosis. Regulates circadian gene expression by repressing the transcriptional activator activity of CLOCK- ARNTL/BMAL1 heterodimer and RORA in a catalytically-independent manner (PubMed:26037310). [The UniProt Consortium]
| Keywords: | Anti-KDM2A, Anti-CXXC8, Anti-F-box protein FBL7, Anti-F-box protein Lilina, Anti-F-box/LRR-repeat protein 11, Anti-Lysine-specific demethylase 2A, Anti-CXXC-type zinc finger protein 8, Anti-[Histone-H3]-lysine-36 demethylase 1A |
| Supplier: | Arigo Biolaboratories |
| Supplier-Nr: | ARG59309 |
Properties
| Application: | WB |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human, mouse (Expected: rat) |
| Immunogen: | Synthetic peptide corresponding to a sequence of Human FBXL11. (KRTFDLEEKLHTNKYNANFVTFMEGKDFNVEYIQR) |
| MW: | 133 kD |
| Format: | Antigen Affinity Purified |
Database Information
| KEGG ID : | K10276 | Matching products |
| UniProt ID : | Q9Y2K7 | Matching products |
| Gene ID : | GeneID 22992 | Matching products |
Handling & Safety
| Storage: | -20°C |
| Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed