Anti-FABP1 (liver)

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R31902 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Fatty acid binding protein 1, liver, also... more
Product information "Anti-FABP1 (liver)"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Fatty acid binding protein 1, liver, also known as FABP1 or FABPL, is a human gene locating at 2p11. FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind free fatty acids, their CoA derivatives, bilirubin, organic anions, and other small molecules. FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metaboism. The liver form of FABP may be identical to the major liver protein-1 (Lvp-1), which is encoded by a gene situated within 1 cM of Ly-2. Protein function: Plays a role in lipoprotein-mediated cholesterol uptake in hepatocytes (PubMed:25732850). Binds cholesterol (PubMed:25732850). Binds free fatty acids and their coenzyme A derivatives, bilirubin, and some other small molecules in the cytoplasm. May be involved in intracellular lipid transport. [The UniProt Consortium]
Keywords: Anti-FABPL, Anti-FABP1, Anti-L-FABP, Anti-Fatty acid-binding protein 1, Anti-Fatty acid-binding protein, liver, Anti-Liver-type fatty acid-binding protein, FABP1 Antibody (liver)
Supplier: NSJ Bioreagents
Supplier-Nr: R31902

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids KYQLQSQENFEAFMKAIGLPEELIQKGKDIK of human FABP were used as the immunogen for the FABP antibody.
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: -20°C (International: -20°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-FABP1 (liver)"
Write a review
or to review a product.
Viewed