Anti-Cytokeratin 5

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG40368.50 50 µg - -

6 - 14 business days*

551.00€
 
Product information "Anti-Cytokeratin 5"
Keywords: Anti-K5, Anti-KRT5, Anti-CK-5, Anti-Keratin-5, Anti-Cytokeratin-5, Anti-58 kDa cytokeratin, Anti-Type-II keratin Kb5, Anti-Keratin, type II cytoskeletal 5
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG40368

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat (Expected: mouse)
Immunogen: Synthetic peptide corresponding to aa. 286-317 of Human Cytokeratin 5. (KVELEAKVDALMDEINFMKMFFDAELSQMQTH)
MW: 62 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Cytokeratin 5"
Write a review
or to review a product.
Viewed