Anti-CREBBP (CREB-binding Protein, CBP)

Anti-CREBBP (CREB-binding Protein, CBP)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
125321.100 100 µg - -

3 - 19 business days*

715.00€
 
CREB Binding Protein plays an important part in regulating cell growth and division through... more
Product information "Anti-CREBBP (CREB-binding Protein, CBP)"
CREB Binding Protein plays an important part in regulating cell growth and division through binding to the KID domain of the transcription factor CREB (short for cAMP response element binding). Abnormalities in the CBP gene leading to a reduction in protein levels can affect normal development causing some of the symptoms associated with Rubinstein-Taybi syndrome. Applications: Suitable for use in Immunofluorescence, ELISA and Western Blot. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: PVHAQPPGTPLSQAAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 125321

Properties

Application: ELISA, IF, WB
Antibody Type: Monoclonal
Clone: 2H5
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Partial recombinant corresponding to aa951-1050 from human CREBBP (NP_004371) with GST tag. MW of the GST tag alone is 26kD.
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CREBBP (CREB-binding Protein, CBP)"
Write a review
or to review a product.
Viewed