Anti-CHRNA1 (Acetylcholine Receptor Subunit alpha, ACHRA, CHNRA)

Anti-CHRNA1 (Acetylcholine Receptor Subunit alpha, ACHRA, CHNRA)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
124973.100 100 µg - -

3 - 19 business days*

715.00€
 
After binding acetylcholine, the AChR responds by an extensive change in conformation that... more
Product information "Anti-CHRNA1 (Acetylcholine Receptor Subunit alpha, ACHRA, CHNRA)"
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. Applications: Suitable for use in ELISA. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: SYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRLP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 124973

Properties

Application: ELISA
Antibody Type: Monoclonal
Clone: 2G5
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Partial recombinant corresponding to aa146-231 from human CHRNA1 (NP_000070.1) with GST tag. MW of the GST tag alone is 26kD.
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CHRNA1 (Acetylcholine Receptor Subunit alpha, ACHRA, CHNRA)"
Write a review
or to review a product.
Viewed