Anti-CCS / SOD4

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59186.50 50 µg - -

10 - 15 business days*

551.00€
 
Protein function: Delivers copper to copper zinc superoxide dismutase (SOD1). [The UniProt... more
Product information "Anti-CCS / SOD4"
Protein function: Delivers copper to copper zinc superoxide dismutase (SOD1). [The UniProt Consortium]
Keywords: Anti-CCS, Anti-Superoxide dismutase copper chaperone, Anti-Copper chaperone for superoxide dismutase
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59186

Properties

Application: IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide corresponding to aa. 174-209 of Human CCS / SOD4. (DADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGR)
MW: 29 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CCS / SOD4"
Write a review
or to review a product.
Viewed