Anti-CCS / Copper chaperone for superoxide dismutase

Anti-CCS / Copper chaperone for superoxide dismutase
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32635 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Copper chaperone for superoxide dismutase... more
Product information "Anti-CCS / Copper chaperone for superoxide dismutase"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Copper chaperone for superoxide dismutase (CCS, SOD4) is a metalloprotein that is responsible for the delivery of Cu to superoxide dismutase (SOD1). In humans the protein is encoded by the CCS gene. And this gene is mapped to chromosome 11q13 by fluorescence in situ hybridization. The CCS protein is present in mammals and most eukaryotes including yeast. The structure of CCS is composed of three distinct domains that are necessary for its function. Although CCS is important for many organisms, there are CCS independent pathways for SOD1, and many species lack CCS all together, such as C. elegans. Protein function: Delivers copper to copper zinc superoxide dismutase (SOD1). [The UniProt Consortium]
Keywords: Anti-CCS, Anti-Superoxide dismutase copper chaperone, Anti-Copper chaperone for superoxide dismutase, CCS Antibody / Copper chaperone for superoxide dismutase
Supplier: NSJ Bioreagents
Supplier-Nr: R32635

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids 174-209 (DADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGR) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CCS / Copper chaperone for superoxide dismutase"
Write a review
or to review a product.
Viewed