Anti-CCKBR

Anti-CCKBR
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ4324 100 µg - -

3 - 10 business days*

755.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The cholecystokinin B receptor, also known... more
Product information "Anti-CCKBR"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. The cholecystokinin B receptor, also known as CCKBR or CCK2, is a protein that in humans is encoded by the CCKBR gene. This gene encodes a G-protein coupled receptor for gastrin and cholecystokinin (CCK), regulatory peptides of the brain and gastrointestinal tract. This protein is a type B gastrin receptor, which has a high affinity for both sulfated and nonsulfated CCK analogs and is found principally in the central nervous system and the gastrointestinal tract. Alternative splicing results in multiple transcript variants. A misspliced transcript variant including an intron has been observed in cells from colorectal and pancreatic tumors. Protein function: Receptor for gastrin and cholecystokinin. The CCK-B receptors occur throughout the central nervous system where they modulate anxiety, analgesia, arousal, and neuroleptic activity. This receptor mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system. [The UniProt Consortium]
Keywords: Anti-CCKBR, Anti-CCKRB, Anti-CCK-BR, Anti-CCK2-R, Anti-CCK-B receptor, Anti-Cholecystokinin-2 receptor, Anti-Gastrin/cholecystokinin type B receptor, CCKBR Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ4324

Properties

Application: WB, FC
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids PVYTVVQPVGPRVLQCVHRWPSARVRQTWS were used as the immunogen for the CCKBR antibody.
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-CCKBR"
Write a review
or to review a product.
Viewed