Anti-Bmi1

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG58309.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Component of a Polycomb group (PcG) multiprotein PRC1- like complex, a complex... more
Product information "Anti-Bmi1"
Protein function: Component of a Polycomb group (PcG) multiprotein PRC1- like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility (PubMed:15386022, PubMed:16359901, PubMed:26151332, PubMed:16714294, PubMed:21772249, PubMed:25355358, PubMed:27827373). The complex composed of RNF2, UB2D3 and BMI1 binds nucleosomes, and has activity only with nucleosomal histone H2A (PubMed:21772249, PubMed:25355358). In the PRC1-like complex, regulates the E3 ubiquitin-protein ligase activity of RNF2/RING2 (PubMed:15386022, PubMed:26151332, PubMed:21772249). [The UniProt Consortium]
Keywords: Anti-BMI1, Anti-PCGF4, Anti-RING finger protein 51, Anti-Polycomb complex protein BMI-1, Anti-Polycomb group RING finger protein 4
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG58309

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat (Expected: bovine)
Immunogen: Synthetic peptide corresponding to a sequence in the middle region of Human Bmi1(135-165aa IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR), different from the related Mouse sequence by four amino acids
MW: 37 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Bmi1"
Write a review
or to review a product.
Viewed