Anti-Beta Tubulin / TUBB, clone 5E4.

Anti-Beta Tubulin / TUBB, clone 5E4.
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ6081 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Tubulin beta chain is a protein that in... more
Product information "Anti-Beta Tubulin / TUBB, clone 5E4."
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Tubulin beta chain is a protein that in humans is encoded by the TUBB gene. This gene encodes a beta tubulin protein. This protein forms a dimer with alpha tubulin and acts as a structural component of microtubules. Mutations in this gene cause cortical dysplasia, complex, with other brain malformations 6. Alternative splicing results in multiple splice variants. There are multiple pseudogenes for this gene on chromosomes 1, 6, 7, 8, 9, and 13. Protein function: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain. [The UniProt Consortium]
Keywords: Anti-TUBB, Anti-TUBB5, Anti-Tubulin beta chain, Anti-Tubulin beta-5 chain, Beta Tubulin Antibody / TUBB
Supplier: NSJ Bioreagents
Supplier-Nr: RQ6081

Properties

Application: WB, IF, FC
Antibody Type: Monoclonal
Clone: 5E4.
Conjugate: No
Host: Mouse
Species reactivity: human, mouse, rat
Immunogen: Amino acids EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Beta Tubulin / TUBB, clone 5E4."
Write a review
or to review a product.
Viewed