Anti-ATX2

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59125.50	50 µg		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Involved in EGFR trafficking, acting as negative regulator of endocytic EGFR... more

Close menu

Product information "Anti-ATX2"

Protein function: Involved in EGFR trafficking, acting as negative regulator of endocytic EGFR internalization at the plasma membrane. [The UniProt Consortium]

Keywords:	Anti-ATX2, Anti-ATXN2, Anti-Ataxin-2, Anti-Spinocerebellar ataxia type 2 protein, Anti-Trinucleotide repeat-containing gene 13 protein
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59125

Properties

Application:	FC, IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat (Expected: hamster)
Immunogen:	Synthetic peptide corresponding to aa. 1283-1313 of Human ATX2. (QSALQPIPVSTTAHFPYMTHPSVQAHHQQQL)
MW:	140 kD
Format:	Antigen Affinity Purified