Anti-Ataxin-2 / ATXN2

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32313 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Ataxin-2, or ATX2, protein is encoded by... more
Product information "Anti-Ataxin-2 / ATXN2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Ataxin-2, or ATX2, protein is encoded by the ATXN2 gene and contains a polyglutamine tract, long expansions (greater than 33 repeats) of which result in spinocerebellar ataxia-2 (SCA2), an autosomal dominant form of olivopontocerebellar atrophy. The gene for spinocerebellar ataxia type 2 (SCA2) has been mapped to 12q24.1. Ataxin-2 associates with L- and T-plastin and that overexpression of ataxin-2 leads to accumulation of T-plastin in mammalian cells. Protein function: Involved in EGFR trafficking, acting as negative regulator of endocytic EGFR internalization at the plasma membrane. [The UniProt Consortium]
Keywords: Anti-ATX2, Anti-ATXN2, Anti-Ataxin-2, Anti-Spinocerebellar ataxia type 2 protein, Anti-Trinucleotide repeat-containing gene 13 protein, Ataxin-2 Antibody / ATXN2
Supplier: NSJ Bioreagents
Supplier-Nr: R32313

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids QSALQPIPVSTTAHFPYMTHPSVQAHHQQQL of human ATXN2
Format: Adhesion & Structure

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-Ataxin-2 / ATXN2"
Write a review
or to review a product.
Viewed