Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| NSJ-R30156 | 100 µg | - | - |
3 - 10 business days* |
790.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. SERCA2, also called ATP2A2 or ATP2B,... more
Product information "Anti-ATP2A2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. SERCA2, also called ATP2A2 or ATP2B, encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. They are closely related to the plasma membrane Ca(2+)-ATPases, or PMCAs. SERCA2 belongs to the large family of P-type cation pumps that couple ATP hydrolysis with cation transport across membranes. The SERCA2 gene is mapped to 12q24.11. SERCA2 was expressed in all specimens, with pronounced expression in the subnuclear aspect of basal epidermal keratinocytes. There was variable suprabasal expression. SERCA2 expression was also observed in the infundibulum and outer root sheath of hair follicles, germinative and mature cells of sebaceous glands, secretory coil and duct of eccrine glands, apocrine gland cells, and arrector pili muscle. In Darier disease skin, strong SERCA2 positivity was detected in the basal, suprabasal, and acantholytic lesional cells. Protein function: This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen. Isoform 2 is involved in the regulation of the contraction/relaxation cycle. [The UniProt Consortium]
| Keywords: | Anti-ATP2B, Anti-ATP2A2, Anti-SERCA2, EC=3.6.3.8, Anti-Calcium pump 2, Anti-SR Ca(2+)-ATPase 2, Anti-Endoplasmic reticulum class 1/2 Ca(2+) ATPase, Anti-Sarcoplasmic/endoplasmic reticulum calcium ATPase 2, ATP2A2 Antibody |
| Supplier: | NSJ Bioreagents |
| Supplier-Nr: | R30156 |
Properties
| Application: | WB, IHC (paraffin) |
| Antibody Type: | Polyclonal |
| Conjugate: | No |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
| Immunogen: | An amino acid sequence from the N-terminus of human ATP2A2 (MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL) was used as the immunogen for this ATP2A2 antibody. |
| Format: | Purified |
Database Information
| KEGG ID : | K05853 | Matching products |
| UniProt ID : | P16615 | Matching products |
| Gene ID : | GeneID 488 | Matching products |
Handling & Safety
| Storage: | +4°C |
| Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed