Anti-ANGPTL2

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59313.50	50 µg		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Induces sprouting in endothelial cells through an autocrine and paracrine... more

Close menu

Product information "Anti-ANGPTL2"

Protein function: Induces sprouting in endothelial cells through an autocrine and paracrine action. [The UniProt Consortium]

Keywords:	Anti-ARP2, Anti-ANGPTL2, Anti-Angiopoietin-like protein 2, Anti-Angiopoietin-related protein 2
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59313

Properties

Application:	IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to aa. 275-312 of Human ANGPTL2. (WRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHD)
MW:	57 kD
Format:	Antigen Affinity Purified