Anti-ANGPTL2

Anti-ANGPTL2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32799 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Angiopoietin-related protein 2, also known... more
Product information "Anti-ANGPTL2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Angiopoietin-related protein 2, also known as Angiopoietin-like protein 2, is a protein that in humans is encoded by the ANGPTL2 gene. Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. ANGPTL2 protein is a secreted glycoprotein with homology to the angiopoietins and may exert a function on endothelial cells through autocrine or paracrine action. Protein function: Induces sprouting in endothelial cells through an autocrine and paracrine action. [The UniProt Consortium]
Keywords: Anti-ARP2, Anti-ANGPTL2, Anti-Angiopoietin-like protein 2, Anti-Angiopoietin-related protein 2, ANGPTL2 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32799

Properties

Application: WB, IHC (paraffin)
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Amino acids 275-312 (WRDCLQALEDGHDTSSIYLVKPENTNRLMQVWCDQRHD) from the human protein
Format: Purified

Database Information

UniProt ID : Q9UKU9 | Matching products
Gene ID : GeneID 23452 | Matching products

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ANGPTL2"
Write a review
or to review a product.
Viewed