Anti-AMH, clone 5/6

Anti-AMH, clone 5/6
%
Discount Promotion
Promotion:

Save 30% on all primary antibodies by Arigo Biolaboratories!

*1
*1 Offer expires 16/12/2024
Item number Size Datasheet Manual SDS Delivery time Quantity Discount Price
ARG22461.250 250 µl - -

6 - 14 business days*

30 %
576.00€
403.20€
 
Protein function: This glycoprotein, produced by the Sertoli cells of the testis, causes... more
Product information "Anti-AMH, clone 5/6"
Protein function: This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin. [The UniProt Consortium]
Keywords: Anti-AMH, Anti-MIF, Anti-MIS, Anti-Anti-Muellerian hormone, Anti-Muellerian-inhibiting factor, Anti-Muellerian-inhibiting substance
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG22461

Properties

Application: IHC (paraffin), WB
Antibody Type: Monoclonal
Clone: 5/6
Conjugate: No
Host: Mouse
Species reactivity: human, mouse, sheep, monkey, baboon
Immunogen: Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-AMH, clone 5/6"
Write a review
or to review a product.
Viewed