Anti-AKAP2

Anti-AKAP2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-R32805 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. A-kinase anchor protein 2 is an enzyme... more
Product information "Anti-AKAP2"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. A-kinase anchor protein 2 is an enzyme that in humans is encoded by the AKAP2 gene. It is mapped to 9q31.3. The protein encoded by this gene binds to the regulatory subunit of protein kinase A and is found associated with the actin cytoskeleton. The encoded protein mediates signals carried by cAMP and may be involved in creating polarity in certain signaling processes. Three transcript variants encoding different isoforms have been found for this gene. Protein function: Binds to regulatory subunit (RII) of protein kinase A. May be involved in establishing polarity in signaling systems or in integrating PKA-RII isoforms with downstream effectors to capture, amplify and focus diffuse, trans-cellular signals carried by cAMP. Binds to and modulates the structure of the actin cytoskeleton. [The UniProt Consortium]
Keywords: Anti-PRKA2, Anti-AKAP-2, Anti-AKAP-KL, Anti-Paralemmin-2, Anti-A-kinase anchor protein 2, Anti-PALM2-AKAP2 fusion protein, Anti-Paralemmin A kinase anchor protein, Anti-Protein kinase A-anchoring protein 2, AKAP2 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: R32805

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse
Immunogen: Amino acids 813-852 (ETHKSKRRERMDDSSVLEATRVNRRKSALALRWEAGIYAN) from the human protein
Format: Purified

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-AKAP2"
Write a review
or to review a product.
Viewed