Anti-AKAP2

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG59317.50	50 µg		-	-	6 - 14 business days*		520.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: Binds to regulatory subunit (RII) of protein kinase A. May be involved in... more

Close menu

Product information "Anti-AKAP2"

Protein function: Binds to regulatory subunit (RII) of protein kinase A. May be involved in establishing polarity in signaling systems or in integrating PKA-RII isoforms with downstream effectors to capture, amplify and focus diffuse, trans-cellular signals carried by cAMP. [The UniProt Consortium]

Keywords:	Anti-AKAP2, Anti-PRKA2, Anti-AKAP-2, Anti-AKAP-KL, Anti-KIAA0920, Anti-A-kinase anchor protein 2, Anti-Protein kinase A-anchoring protein 2
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG59317

Properties

Application:	WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, rat
Immunogen:	Synthetic peptide corresponding to aa. 813-852 of Human AKAP2. (ETHKSKRRERMDDSSVLEATRVNRRKSALALRWEAGIYAN)
MW:	95 kD
Format:	Antigen Affinity Purified