Anti-AKAP2

Anti-AKAP2
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG59317.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Binds to regulatory subunit (RII) of protein kinase A. May be involved in... more
Product information "Anti-AKAP2"
Protein function: Binds to regulatory subunit (RII) of protein kinase A. May be involved in establishing polarity in signaling systems or in integrating PKA-RII isoforms with downstream effectors to capture, amplify and focus diffuse, trans-cellular signals carried by cAMP. [The UniProt Consortium]
Keywords: Anti-AKAP2, Anti-PRKA2, Anti-AKAP-2, Anti-AKAP-KL, Anti-KIAA0920, Anti-A-kinase anchor protein 2, Anti-Protein kinase A-anchoring protein 2
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG59317

Properties

Application: WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, rat
Immunogen: Synthetic peptide corresponding to aa. 813-852 of Human AKAP2. (ETHKSKRRERMDDSSVLEATRVNRRKSALALRWEAGIYAN)
MW: 95 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-AKAP2"
Write a review
or to review a product.
Viewed