Anti-AHR (Aryl Hydrocarbon Receptor, Ah Receptor, AhR, Class E Basic Helix-loop-helix Protein 76, bH

Anti-AHR (Aryl Hydrocarbon Receptor, Ah Receptor, AhR, Class E Basic Helix-loop-helix Protein 76, bH
Item number Size Datasheet Manual SDS Delivery time Quantity Price
123091.100 100 µg - -

3 - 19 business days*

715.00€
 
Aryl hydrocarbon receptor is a ligand-activated transcription factor involved in the regulation... more
Product information "Anti-AHR (Aryl Hydrocarbon Receptor, Ah Receptor, AhR, Class E Basic Helix-loop-helix Protein 76, bH"
Aryl hydrocarbon receptor is a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. AHR has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Applications: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunoprecipitation. Other applications not tested. Recommended Dilution: Immunofluorescence: 10ug/ml, Optimal dilutions to be determined by the researcher. AA Sequence: MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINN, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Supplier: United States Biological
Supplier-Nr: 123091

Properties

Application: ELISA, IF, IP, WB
Antibody Type: Monoclonal
Clone: 3B12
Conjugate: No
Host: Mouse
Species reactivity: human
Immunogen: Partial recombinant corresponding to aa721-820 from human AHR (NP_001612) with GST tag. MW of the GST tag alone is 26kD.
Purity: Purified by Protein A affinity chromatography.
Format: Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-AHR (Aryl Hydrocarbon Receptor, Ah Receptor, AhR, Class E Basic Helix-loop-helix Protein 76, bH"
Write a review
or to review a product.
Viewed