Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
NSJ-RQ4625 | 100 µg | - | - |
3 - 10 business days* |
755.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Alpha-actinin-3, also known as... more
Product information "Anti-ACTN3 / Alpha Actinin 3, clone 9B5"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants, the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status. Protein function: F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein. [The UniProt Consortium]
Keywords: | Anti-ACTN3, Anti-Alpha-actinin-3, Anti-F-actin cross-linking protein, Anti-Alpha-actinin skeletal muscle isoform 3, ACTN3 Antibody / Alpha Actinin 3 |
Supplier: | NSJ Bioreagents |
Supplier-Nr: | RQ4625 |
Properties
Application: | WB, IHC (paraffin) |
Antibody Type: | Monoclonal |
Clone: | 9B5 |
Conjugate: | No |
Host: | Mouse |
Species reactivity: | mouse, rat |
Immunogen: | Amino acids EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK |
Format: | Purified |
Database Information
KEGG ID : | K21073 | Matching products |
UniProt ID : | Q08043 | Matching products |
Gene ID | GeneID 89 | Matching products |
Handling & Safety
Storage: | +4°C |
Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed