Anti-alpha Actinin 3

Item number	Size	Datasheet	Manual	SDS	Delivery time	Quantity	Price
ARG40278.50	50 µg		-	-	6 - 14 business days*		551.00€

If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk

Protein function: F-actin cross-linking protein which is thought to anchor actin to a variety of... more

Close menu

Product information "Anti-alpha Actinin 3"

Protein function: F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein. [The UniProt Consortium]

Keywords:	Anti-ACTN3, Anti-Alpha-actinin-3, Anti-F-actin cross-linking protein, Anti-Alpha-actinin skeletal muscle isoform 3
Supplier:	Arigo Biolaboratories
Supplier-Nr:	ARG40278

Properties

Application:	FC, IHC (paraffin), WB
Antibody Type:	Polyclonal
Conjugate:	No
Host:	Rabbit
Species reactivity:	human, mouse, rat
Immunogen:	Synthetic peptide corresponding to aa. 574-617 of Human alpha Actinin 3. (EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQDINTK)
MW:	103 kD
Format:	Antigen Affinity Purified