Products from Atlas Antibodies
Atlas Antibodies AB from Stockholm (Sweden) aims to make the unique antibodies used in the Human Protein Atlas project available to all interested researchers. Based on the idea to create a complete map of human protein expression and localization, the project developed its own set of highly specific antibodies that met the quality demands of such an ambitious project. These unique antibodies were made commercially available in 2006 by Atlas Antibodies as Triple A (Atlas Antibodies Advanced) Polyclonals. Since then, Atlas Antibodies has also introduced PrecisA Monoclonals (the swedish word "precisa" stands for precise, accurate and targeted) and PrEST Antigens (recombinant human Protein Epitope Signature Tags). All of these products are based on the same high-quality manufacturing principles.
More information at: www.atlasantibodies.com
No results were found for the filter!
PACS1 PrEST Antigen
Item number: ATA-APrEST96148.100
PrEST Antigen PACS1, Gene description: phosphofurin acidic cluster sorting protein 1, Alternative Gene Names: FLJ10209, KIAA1175, Antigen sequence: GSVDSKYSSSFLDSGWRDLFSRSEPPVSEQLDVAGRVMQYVNGAATTHQLP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Coat protein that is...
| Keywords: | PACS1, PACS-1, KIAA1175, Phosphofurin acidic cluster sorting protein 1 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
C15orf40 PrEST Antigen
Item number: ATA-APrEST96150.100
PrEST Antigen C15orf40, Gene description: chromosome 15 open reading frame 40, Alternative Gene Names: MGC29937, Antigen sequence: MPKKAGATTKGKSQSKEPERPLPPLGPVAVDPKGCVTIAIHAKPGSKQNAVTDLTAEAV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 78% Rat gene identity: 78%
| Keywords: | C15orf40, UPF0235 protein C15orf40 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
MUC5AC PrEST Antigen
Item number: ATA-APrEST96151.100
PrEST Antigen MUC5AC, Gene description: mucin 5AC, oligomeric mucus/gel-forming, Alternative Gene Names: MUC5, Antigen sequence: LLSHNTKLTPMEFGNLQKMDDPTEQCQDPVPEPPRNCSTGFGICEELLHGQLFSGCVALVDVGSYLEACRQDLCFCE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Gel-forming...
| Keywords: | TBM, MUC-5AC, Mucin-5AC, Gastric mucin, Tracheobronchial mucin, Major airway glycoprotein, Mucin-5 subtype AC,... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
CYP11B2 PrEST Antigen
Item number: ATA-APrEST96158.100
PrEST Antigen CYP11B2, Gene description: cytochrome P450 family 11 subfamily B member 2, Alternative Gene Names: ALDOS, CPN2, CYP11B, CYP11BL, P-450C18, P450aldo, Antigen sequence: WVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: A...
| Keywords: | ALDOS, CYPXIB2, Cytochrome P-450C18, Aldosterone synthase, Cytochrome P-450Aldo, Steroid 18-hydroxylase,... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
ESR2 PrEST Antigen
Item number: ATA-APrEST96163.100
PrEST Antigen ESR2, Gene description: estrogen receptor 2, Alternative Gene Names: ER-beta, Erb, NR3A2, Antigen sequence: LNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Keywords: | ESR2, ESTRB, ER-beta, Estrogen receptor beta, Nuclear receptor subfamily 3 group A member 2 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
PDCD6IP PrEST Antigen
Item number: ATA-APrEST96165.100
PrEST Antigen PDCD6IP, Gene description: programmed cell death 6 interacting protein, Alternative Gene Names: AIP1, Alix, Hp95, Antigen sequence: GVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Multifunctional...
| Keywords: | AIP1, Hp95, PDCD6IP, PDCD6-interacting protein, ALG-2-interacting protein 1, ALG-2-interacting protein X, Programmed cell... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
CMPK2 PrEST Antigen
Item number: ATA-APrEST96168.100
PrEST Antigen CMPK2, Gene description: cytidine/uridine monophosphate kinase 2, Alternative Gene Names: NDK, TYKi, UMP-CMPK2, Antigen sequence: DRYWHSTATYAIATEVSGGLQHLPPAHHPVYQWPEDLLKPDLILLLTVSPEERLQRLQGRGMEKTREEAELEANSVFRQKVEMSYQRMENPGCHVV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
| Keywords: | CMPK2, EC=2.7.4.6, EC=2.7.4.14, Nucleoside-diphosphate kinase, UMP-CMP kinase 2, mitochondrial |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
CD1E PrEST Antigen
Item number: ATA-APrEST96173.100
PrEST Antigen CD1E, Gene description: CD1e molecule, Antigen sequence: ISWEPSPGAGIRAQNICKVLNRYLDIKEILQSLLGHTCPRFLAGLMEAGESELKRKVKP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: T-cell surface glycoprotein CD1e, soluble binds diacetylated lipids, including phosphatidyl...
| Keywords: | CD1E |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
ARHGEF6 PrEST Antigen
Item number: ATA-APrEST96184.100
PrEST Antigen ARHGEF6, Gene description: Rac/Cdc42 guanine nucleotide exchange factor 6, Alternative Gene Names: alpha-PIX, alphaPIX, Cool-2, Cool2, KIAA0006, MRX46, Antigen sequence: GSVEKFCLDPQTEADCINNINDFLKGCATLQVEIFDPDDLYSGVNFSKVLSTLLAVNKATEDQLSERPCGRSSSLSAANTSQTNPQGAVSSTVSGLQR, Storage: Upon delivery store at...
| Keywords: | COOL2, COOL-2, ARHGEF6, Alpha-Pix, PAK-interacting exchange factor alpha, Rho guanine nucleotide exchange factor 6,... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
RNASEL PrEST Antigen
Item number: ATA-APrEST96189.100
PrEST Antigen RNASEL, Gene description: ribonuclease L, Alternative Gene Names: PRCA1, RNS4, Antigen sequence: IKTRKSESEILRLLQPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGAGGA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
| Keywords: | RNS4, RNASEL, RNase L, EC=3.1.26.-, Ribonuclease 4, Ribonuclease L, 2-5A-dependent RNase, 2-5A-dependent ribonuclease |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
TAGLN PrEST Antigen
Item number: ATA-APrEST96196.100
PrEST Antigen TAGLN, Gene description: transgelin, Alternative Gene Names: DKFZp686P11128, SM22, SMCC, TAGLN1, WS3-10, Antigen sequence: KNDGHYRGDPNWFMKKAQEHKREFTESQLQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Actin cross-linking/gelling protein. Involved in calcium...
| Keywords: | SM22, TAGLN, SM22-alpha, Transgelin, Protein WS3-10, 22 kDa actin-binding protein, Smooth muscle protein 22-alpha |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
H3-3B PrEST Antigen
Item number: ATA-APrEST96214.100
PrEST Antigen H3-3B, Gene description: H3.3 histone B, Alternative Gene Names: H3.3B, H3F3B, Antigen sequence: KPHRYRPGTVALREIRRYQKSTELLIR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Variant histone H3 which replaces conventional H3 in a wide range of nucleosomes in...
| Keywords: | H3.3B, PP781, H3.3A, Histone H3.3 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*