CD1E PrEST Antigen

CD1E PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST96173.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen CD1E, Gene description: CD1e molecule, Antigen sequence:... more
Product information "CD1E PrEST Antigen"
PrEST Antigen CD1E, Gene description: CD1e molecule, Antigen sequence: ISWEPSPGAGIRAQNICKVLNRYLDIKEILQSLLGHTCPRFLAGLMEAGESELKRKVKP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: T-cell surface glycoprotein CD1e, soluble binds diacetylated lipids, including phosphatidyl inositides and diacylated sulfoglycolipids, and is required for the presentation of glycolipid antigens on the cell surface. The membrane-associated form is not active. [The UniProt Consortium] Mouse gene identity: 42% Rat gene identity: 42%
Keywords: CD1E
Supplier: Atlas Antibodies
Supplier-Nr: APrEST96173

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "CD1E PrEST Antigen"
Write a review
or to review a product.
Viewed