PACS1 PrEST Antigen

PACS1 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST96148.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen PACS1, Gene description: phosphofurin acidic cluster sorting protein 1, Alternative... more
Product information "PACS1 PrEST Antigen"
PrEST Antigen PACS1, Gene description: phosphofurin acidic cluster sorting protein 1, Alternative Gene Names: FLJ10209, KIAA1175, Antigen sequence: GSVDSKYSSSFLDSGWRDLFSRSEPPVSEQLDVAGRVMQYVNGAATTHQLP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Coat protein that is involved in the localization of trans- Golgi network (TGN) membrane proteins that contain acidic cluster sorting motifs. Controls the endosome-to-Golgi trafficking of furin and mannose-6-phosphate receptor by connecting the acidic-cluster- containing cytoplasmic domain of these molecules with the adapter- protein complex-1 (AP-1) of endosomal clathrin-coated membrane pits. Involved in HIV-1 nef-mediated removal of MHC-I from the cell surface to the TGN. [The UniProt Consortium] Mouse gene identity: 88% Rat gene identity: 88%
Keywords: PACS1, PACS-1, KIAA1175, Phosphofurin acidic cluster sorting protein 1
Supplier: Atlas Antibodies
Supplier-Nr: APrEST96148

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "PACS1 PrEST Antigen"
Write a review
or to review a product.
Viewed