ESR2 PrEST Antigen

PrEST Antigen ESR2, Gene description: estrogen receptor 2, Alternative Gene Names: ER-beta, Erb, NR3A2, Antigen sequence: LNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Nuclear hormone receptor. Binds estrogens with an affinity similar to that of ESR1, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner (PubMed:20074560). Isoform beta-cx lacks ligand binding ability and has no or only very low ere binding activity resulting in the loss of ligand-dependent transactivation ability. DNA-binding by ESR1 and ESR2 is rapidly lost at 37 degrees Celsius in the absence of ligand while in the presence of 17 beta-estradiol and 4-hydroxy-tamoxifen loss in DNA-binding at elevated temperature is more gradual. [The UniProt Consortium] Mouse gene identity: 81% Rat gene identity: 81%