Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| ATA-APrEST96165.100 | 100 µl |
7 - 10 business days* |
264.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
PrEST Antigen PDCD6IP, Gene description: programmed cell death 6 interacting protein, Alternative... more
Product information "PDCD6IP PrEST Antigen"
PrEST Antigen PDCD6IP, Gene description: programmed cell death 6 interacting protein, Alternative Gene Names: AIP1, Alix, Hp95, Antigen sequence: GVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Multifunctional protein involved in endocytosis, multivesicular body biogenesis, membrane repair, cytokinesis, apoptosis and maintenance of tight junction integrity. Class E VPS protein involved in concentration and sorting of cargo proteins of the multivesicular body (MVB) for incorporation into intralumenal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome. Binds to the phospholipid lysobisphosphatidic acid (LBPA) which is abundant in MVBs internal membranes. The MVB pathway requires the sequential function of ESCRT-O, -I,-II and -III complexes (PubMed:14739459). The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis (PubMed:17853893, PubMed:17556548). Adapter for a subset of ESCRT-III proteins, such as CHMP4, to function at distinct membranes. Required for completion of cytokinesis (PubMed:17853893, PubMed:17556548, PubMed:18641129). May play a role in the regulation of both apoptosis and cell proliferation. Regulates exosome biogenesis in concert with SDC1/4 and SDCBP (PubMed:22660413). By interacting with F-actin, PARD3 and TJP1 secures the proper assembly and positioning of actomyosin-tight junction complex at the apical sides of adjacent epithelial cells that defines a spatial membrane domain essential for the maintenance of epithelial cell polarity and barrier. [The UniProt Consortium] Mouse gene identity: 97% Rat gene identity: 97%
| Keywords: | AIP1, Hp95, PDCD6IP, PDCD6-interacting protein, ALG-2-interacting protein 1, ALG-2-interacting protein X, Programmed cell death 6-interacting protein |
| Supplier: | Atlas Antibodies |
| Supplier-Nr: | APrEST96165 |
Properties
| Conjugate: | No |
| Host: | E.coli |
| Species reactivity: | human |
| Format: | Solution |
Database Information
| KEGG ID : | K12200 | Matching products |
| UniProt ID : | Q8WUM4 | Matching products |
| Gene ID : | GeneID 10015 | Matching products |
Handling & Safety
| Storage: | -20°C (avoid repeat freezing and thawing cycles) |
| Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed