PDCD6IP PrEST Antigen

PDCD6IP PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST96165.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen PDCD6IP, Gene description: programmed cell death 6 interacting protein, Alternative... more
Product information "PDCD6IP PrEST Antigen"
PrEST Antigen PDCD6IP, Gene description: programmed cell death 6 interacting protein, Alternative Gene Names: AIP1, Alix, Hp95, Antigen sequence: GVINEEALSVTELDRVYGGLTTKVQESLKKQEGLLKNIQVSHQEFSKMKQSNNEANLR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Multifunctional protein involved in endocytosis, multivesicular body biogenesis, membrane repair, cytokinesis, apoptosis and maintenance of tight junction integrity. Class E VPS protein involved in concentration and sorting of cargo proteins of the multivesicular body (MVB) for incorporation into intralumenal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome. Binds to the phospholipid lysobisphosphatidic acid (LBPA) which is abundant in MVBs internal membranes. The MVB pathway requires the sequential function of ESCRT-O, -I,-II and -III complexes (PubMed:14739459). The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis (PubMed:17853893, PubMed:17556548). Adapter for a subset of ESCRT-III proteins, such as CHMP4, to function at distinct membranes. Required for completion of cytokinesis (PubMed:17853893, PubMed:17556548, PubMed:18641129). May play a role in the regulation of both apoptosis and cell proliferation. Regulates exosome biogenesis in concert with SDC1/4 and SDCBP (PubMed:22660413). By interacting with F-actin, PARD3 and TJP1 secures the proper assembly and positioning of actomyosin-tight junction complex at the apical sides of adjacent epithelial cells that defines a spatial membrane domain essential for the maintenance of epithelial cell polarity and barrier. [The UniProt Consortium] Mouse gene identity: 97% Rat gene identity: 97%
Keywords: AIP1, Hp95, PDCD6IP, PDCD6-interacting protein, ALG-2-interacting protein 1, ALG-2-interacting protein X, Programmed cell death 6-interacting protein
Supplier: Atlas Antibodies
Supplier-Nr: APrEST96165

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "PDCD6IP PrEST Antigen"
Write a review
or to review a product.
Viewed