CYP11B2 PrEST Antigen

CYP11B2 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST96158.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen CYP11B2, Gene description: cytochrome P450 family 11 subfamily B member 2,... more
Product information "CYP11B2 PrEST Antigen"
PrEST Antigen CYP11B2, Gene description: cytochrome P450 family 11 subfamily B member 2, Alternative Gene Names: ALDOS, CPN2, CYP11B, CYP11BL, P-450C18, P450aldo, Antigen sequence: WVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: A cytochrome P450 monooxygenase that catalyzes the biosynthesis of adrenal mineralocorticoid aldosterone (PubMed:11856349, PubMed:23322723, PubMed:1594605, PubMed:9814506). Catalyzes three sequential oxidative reactions of 11-deoxycorticosterone/21- hydroxyprogesterone, namely 11-beta hydroxylation followed with two successive oxidations at C18 to yield 18-hydroxy and then 18-aldehyde derivatives, resulting in the formation of aldosterone (PubMed:11856349, PubMed:23322723, PubMed:1594605, PubMed:9814506). Mechanistically, uses molecular oxygen inserting one oxygen atom into a substrate and reducing the second into a water molecule. Two electrons are provided by NADPH via a two-protein mitochondrial transfer system comprising flavoprotein FDXR (adrenodoxin/ferredoxin reductase) and nonheme iron-sulfur protein FDX1 or FDX2 (adrenodoxin/ferredoxin) (PubMed:11856349, PubMed:23322723, PubMed:1594605, PubMed:9814506). [The UniProt Consortium] Mouse gene identity: 74% Rat gene identity: 74%
Keywords: ALDOS, CYPXIB2, Cytochrome P-450C18, Aldosterone synthase, Cytochrome P-450Aldo, Steroid 18-hydroxylase, Aldosterone-synthesizing enzyme, Cytochrome P450 11B2, mitochondrial, Steroid 11-beta-hydroxylase, CYP11B2, Corticosterone 18-monooxygenase, CYP11B2
Supplier: Atlas Antibodies
Supplier-Nr: APrEST96158

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "CYP11B2 PrEST Antigen"
Write a review
or to review a product.
Viewed