7 products were found matching "K18047"!
No results were found for the filter!
STYXL1, N-terminal FLAG-tag, human recombinant protein
Item number: BPS-30027
.
| Keywords: | DUSP24, STYXL1, Dual specificity protein phosphatase 24, Map kinase phosphatase-like protein MK-STYX, Dual specificity... |
| Application: | Binding assays, autoimmune assays |
| Expressed in: | Baculovirus |
| Origin: | human |
| MW: | 37.8 kD |
650.00€
*
Anti-STYXL1
Item number: G-CAB12850.100
WB 1:500 - 1:2000. Protein function: Catalytically inactive phosphatase (PubMed:20180778, PubMed:23163895). By binding to G3BP1, inhibits the formation of G3BP1-induced stress granules (PubMed:20180778, PubMed:23163895). Does not act by protecting the dephosphorylation of G3BP1 at 'Ser- 149' (PubMed:23163895)....
| Keywords: | Anti-STYXL1, Anti-DUSP24, Anti-Dual specificity protein phosphatase 24, Anti-Map kinase phosphatase-like protein MK-STYX,... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 352.00€
*
Anti-STYXL1
Item number: ATA-HPA050261.100
Protein function: Catalytically inactive phosphatase (PubMed:20180778, PubMed:23163895). By binding to G3BP1, inhibits the formation of G3BP1- induced stress granules (PubMed:20180778, PubMed:23163895). Does not act by protecting the dephosphorylation of G3BP1 at 'Ser-149' (PubMed:23163895). Inhibits PTPMT1...
| Keywords: | Anti-STYXL1, Anti-DUSP24, Anti-Dual specificity protein phosphatase 24, Anti-Map kinase phosphatase-like protein MK-STYX,... |
| Application: | ICC, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 335.00€
*
Anti-STYXL1
Item number: E-AB-90509.120
Catalytically inactive phosphatase. By binding to G3BP1, inhibits the formation of G3BP1-induced stress granules. Does not act by protecting the dephosphorylation of G3BP1 at 'Ser-149'. Inhibits PTPMT1 phosphatase activity. By inhibiting PTPMT1, positively regulates intrinsic apoptosis. May play a role in the...
| Keywords: | DUSP24, STYXL1, Dual specificity protein phosphatase 24, Map kinase phosphatase-like protein MK-STYX, Dual specificity... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 198.00€
*
STYXL1, Recombinant, Human, aa2-313, FLAG-tag...
Item number: 298463.100
Source:, Recombinant protein corresponding to aa2-313 from human STYXL1, fused to FLAG-tag at N-terminal, expressed in Sf9 insect cells. Molecular Weight: ~37.8kD, AA Sequence: MDYKDDDDKLEVLFQGPLPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEY, DESHVITALRVKKKNNEYLLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDG,...
| Keywords: | STYXL1, DUSP24, Dual specificity protein phosphatase 24, Map kinase phosphatase-like protein MK-STYX, Dual specificity... |
| MW: | 37,8 |
1,121.00€
*
STYXL1 PrEST Antigen
Item number: ATA-APrEST73630.100
Protein function: Catalytically inactive phosphatase (PubMed:20180778, PubMed:23163895). By binding to G3BP1, inhibits the formation of G3BP1- induced stress granules (PubMed:20180778, PubMed:23163895). Does not act by protecting the dephosphorylation of G3BP1 at 'Ser-149' (PubMed:23163895). Inhibits PTPMT1...
| Keywords: | STYXL1, DUSP24, Dual specificity protein phosphatase 24, Map kinase phosphatase-like protein MK-STYX, Dual specificity... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
247.00€
*
Anti-STYXL1
Item number: G-CAB12850.20
Protein function: Catalytically inactive phosphatase (PubMed:20180778, PubMed:23163895). By binding to G3BP1, inhibits the formation of G3BP1- induced stress granules (PubMed:20180778, PubMed:23163895). Does not act by protecting the dephosphorylation of G3BP1 at 'Ser-149' (PubMed:23163895). Inhibits PTPMT1...
| Keywords: | Anti-STYXL1, Anti-DUSP24, Anti-Dual specificity protein phosphatase 24, Anti-Map kinase phosphatase-like protein MK-STYX,... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
149.00€
*