STYXL1, Recombinant, Human, aa2-313, FLAG-tag (Serine/Threonine/Tyrosine Interacting-Like 1, Dual Sp

Source:, Recombinant protein corresponding to aa2-313 from human STYXL1, fused to FLAG-tag at N-terminal, expressed in Sf9 insect cells. Molecular Weight: ~37.8kD, AA Sequence: MDYKDDDDKLEVLFQGPLPGLLLCEPTELYNILNQATKLSRLTDPNYLCLLDVRSKWEY, DESHVITALRVKKKNNEYLLPESVDLECVKYCVVYDNNSSTLEILLKDDDDDSDSDGDG, KDLVPQAAIEYGRILTRLTHHPVYILKGGYERFSGTYHFLRTQKIIWMPQELDAFQPYPIEI, VPGKVFVGNFSQACDPKIQKDLKIKAHVNVSMDTGPFFAGDADKLLHIRIEDSPEAQILP, FLRHMCHFIEIHHHLGSVILIFSTQGISRSCAAIIAYLMHSNEQTLQRSWAYVKKCKNNMC, PNRGLVSQLLEWEKTILGDSITNIMDPLY, Applications: Suitable for use as an immunogen, in binding assays or as an antigen in autoimmune assays. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.