fMet-Leu-Phe Receptor, Recombinant, Mouse, aa1-35, His-GST-Tag, Myc-Tag (FPR1)

High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Source: Recombinant protein corresponding to aa1-35 of mouse fMet-Leu-Phe Receptor, fused to 10xHis-GST-Tag at N-terminal and Myc-Tag at C-terminal, expressed in E. coli. Molecular Weight: ~33.7kD, AA Sequence: MDTNMSLLMNKSAVNLMNVSGSTQSVSAGYIVLDV, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.