CBX7, Recombinant, Human, aa2-90, GST-tag (Chromobox Homolog 7)

Source:, Recombinant protein corresponding to aa2-90 from human CBX7, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~11.6kD, AA Sequence: MHHHHHHELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDP, RLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLR, Applications: Suitable for use in protein binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.