14 products were found matching "K11454"!

UNC3866 is an inhibitor of chromobox homolog 7 (CBX7, Kd = 97 nM). It also binds to CBX4 (Kd = 94 nM) but is greater than 6-fold selective over CBX2, 6, and 8 and the chromodomain Y family (CDY) chromodomains CDY1, L1b, and L2 (Kds = 0.61-6.3 µM). UNC3866 pretreatment (30 µM) of PC3 lysates completely inhibits...

Chromobox homolog 7 (CBX7) functions through its N-terminal chromodomain, which recognizes histone 3 trimethyl lysine 27 (H3K27me3), to repress gene transcription. It plays a key role in gene transcription in cellular processes related to stem cell self-renewal and differentiation, as well as tumor progression....

Protein function: Component of a Polycomb group (PcG) multiprotein PRC1- like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, it mediates...

Human chromobox homolog 7 (CBX7), GenBank Accession No. NM_175709, a.a. 2-90, with N-terminal His-tag, MW=11.6 kDa, expressed in an E. coli cell expression system.

Protein function: Component of a Polycomb group (PcG) multiprotein PRC1- like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, it mediates...

CBX7 (Chromobox protein homolog 7) is a 251 amino acid nuclear protein that contains one N-terminal chromo domain and one C-terminal Pc box. Highly expressed in kidney, brain, heart and skeletal muscle, with weaker expression in peripheral blood leukocytes, CBX7 functions as a component of the chromatin-associated...

Antibody in PBS with 0.02% sodium azide, 50% glycerol and 0.4-0.5mg/ml BSA. Control of cell proliferation by Polycomb group proteins (PcG) is an important facet of cellular homeostasis and its disruption can promote tumorigenesis. 'Chromobox protein homolog 7' is a PcG protein which is found to control the growth of...

Protein function: Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, it mediates...

Protein function: Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, it mediates...

Source:, Recombinant protein corresponding to aa2-90 from human CBX7, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~11.6kD, AA Sequence: MHHHHHHELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDP, RLVMAYEEKEERDRASGYRKRGPKPKRLLLQRLYSMDLR, Applications: Suitable for use in protein binding...

Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, it mediates monoubiquitination of...

Protein function: Component of a Polycomb group (PcG) multiprotein PRC1-like complex, a complex class required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones, it mediates...