Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Close filters
Filter by:
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
from to

Proteins and Enzymes

Proteins are found in every cell and form the basis of all biological processes. As molecular tools, they perform countless vital tasks in the body, for example by transporting metabolites, catalyzing chemical reactions, enabling cell movement or regulating gene expression. We offer a wide range of protein products, including enzymes, recombinant proteins and hormones. These products support researchers in molecular biology, cell biology, biochemistry and other scientific fields and can be used in a variety of applications, such as enzymatic assays, Western blots or protein-protein interaction studies.

Proteins are found in every cell and form the basis of all biological processes. As molecular tools, they perform countless vital tasks in the body, for example by transporting metabolites,... read more »
Close window
Proteins and Enzymes

Proteins are found in every cell and form the basis of all biological processes. As molecular tools, they perform countless vital tasks in the body, for example by transporting metabolites, catalyzing chemical reactions, enabling cell movement or regulating gene expression. We offer a wide range of protein products, including enzymes, recombinant proteins and hormones. These products support researchers in molecular biology, cell biology, biochemistry and other scientific fields and can be used in a variety of applications, such as enzymatic assays, Western blots or protein-protein interaction studies.

Filter
10872 from 10992 pages
No results were found for the filter!
CEP63 PrEST Antigen
CEP63 PrEST Antigen

Item number: ATA-APrEST95920.100

Atlas Antibodies
PrEST Antigen CEP63, Gene description: centrosomal protein 63, Alternative Gene Names: FLJ13386, Antigen sequence: REQELKSLRSQLDVTHKEVGMLHQQVEEHEKIKQEMTMEYKQELKKLHEELCILKRSYEKLQKKQMREFRGNTKNHREDRSEIE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Required for normal...
Keywords: Cep63, Centrosomal protein of 63 kDa
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
RABL3 PrEST Antigen
RABL3 PrEST Antigen

Item number: ATA-APrEST95921.100

Atlas Antibodies
PrEST Antigen RABL3, Gene description: RAB, member of RAS oncogene family like 3, Alternative Gene Names: MGC23920, Antigen sequence: NKKSSQNLRRWSLEALNRDLVPTGVLVTNGDYDQEQFADNQIPLLVIGTKLDQIHETKRHEVLTRTAF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Required for KRAS...
Keywords: RABL3, Rab-like protein 3
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
UBR1 PrEST Antigen
UBR1 PrEST Antigen

Item number: ATA-APrEST95926.100

Atlas Antibodies
PrEST Antigen UBR1, Gene description: ubiquitin protein ligase E3 component n-recognin 1, Antigen sequence: LHTTAIDKEGRRAVKAGAYAACQEAKEDIKSHSENVSQHPLHVEVLHSEIMAHQKFALRLGSWMNKIMSYSSDFR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: E3 ubiquitin-protein ligase which is a...
Keywords: UBR1, EC=2.3.2.27, N-recognin-1, E3 ubiquitin-protein ligase UBR1, Ubiquitin-protein ligase E3-alpha-1, Ubiquitin-protein...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
LEMD1 PrEST Antigen
LEMD1 PrEST Antigen

Item number: ATA-APrEST95935.100

Atlas Antibodies
PrEST Antigen LEMD1, Gene description: LEM domain containing 1, Alternative Gene Names: CT50, LEMP-1, Antigen sequence: DVKCLSDCKLQNQLEKLGFSPGPILPSTRKLY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 75% Rat gene identity: 75%
Keywords: CT50, LEMD1, LEMP-1, LEM domain protein 1, Cancer/testis antigen 50, LEM domain-containing protein 1
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
MFSD4A PrEST Antigen
MFSD4A PrEST Antigen

Item number: ATA-APrEST95937.100

Atlas Antibodies
PrEST Antigen MFSD4A, Gene description: major facilitator superfamily domain containing 4A, Alternative Gene Names: DKFZp761N1114, FLJ25004, FLJ34577, MFSD4, SLC60A1, UNQ3064, Antigen sequence: SKERLLTCCPQRRPLLLSADELALETQPPEKEDASSLPPKFQSHLGHEDLFSCCQRKNLRGA, Storage: Upon delivery store at -20°C. Avoid repeated...
Keywords: MFSD4, Major facilitator superfamily domain-containing protein 4, Major facilitator superfamily domain-containing protein 4A
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
KCNA6 PrEST Antigen
KCNA6 PrEST Antigen

Item number: ATA-APrEST95945.100

Atlas Antibodies
PrEST Antigen KCNA6, Gene description: potassium voltage-gated channel subfamily A member 6, Alternative Gene Names: HBK2, Kv1.6, PPP1R96, Antigen sequence: EQGQYTHVTCGQPAPDLRATDNGLGKPDFPEANRERRPSYLPTPHRAYAE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Voltage-gated...
Keywords: KCNA6, Voltage-gated potassium channel HBK2, Voltage-gated potassium channel subunit Kv1.6, Potassium voltage-gated...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
RXRB PrEST Antigen
RXRB PrEST Antigen

Item number: ATA-APrEST95947.100

Atlas Antibodies
PrEST Antigen RXRB, Gene description: retinoid X receptor beta, Alternative Gene Names: H-2RIIBP, NR2B2, RCoR-1, RXR-beta, RXRbeta, Antigen sequence: MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Receptor for retinoic acid....
Keywords: RXRB, NR2B2, Retinoid X receptor beta, Retinoic acid receptor RXR-beta, Nuclear receptor subfamily 2 group B member 2
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
N4BP2L1 PrEST Antigen
N4BP2L1 PrEST Antigen

Item number: ATA-APrEST95951.100

Atlas Antibodies
PrEST Antigen N4BP2L1, Gene description: NEDD4 binding protein 2 like 1, Alternative Gene Names: CG018, Antigen sequence: SGKTTLARQLQHDFPRALIFSTDDFFFREDGAYEFNPDFLEEAHEWNQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 90% Rat gene identity: 90%
Keywords: CG081, N4BP2L1, NEDD4-binding protein 2-like 1
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
TNK2 PrEST Antigen
TNK2 PrEST Antigen

Item number: ATA-APrEST95953.100

Atlas Antibodies
PrEST Antigen TNK2, Gene description: tyrosine kinase non receptor 2, Alternative Gene Names: ACK, ACK1, p21cdc42Hs, Antigen sequence: PQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGRAENYWWRGQNTRTLCVGPFPRNVVTSVAGLSAQDISQPLQNSFIHTGHG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
Keywords: TNK2, ACK1, ACK-1, Activated CDC42 kinase 1, Tyrosine kinase non-receptor protein 2
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
LEP PrEST Antigen
LEP PrEST Antigen

Item number: ATA-APrEST95954.100

Atlas Antibodies
PrEST Antigen LEP, Gene description: leptin, Alternative Gene Names: OB, OBS, Antigen sequence: IQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Key player in the regulation of energy balance and...
Keywords: Leptin, Obese protein, Obesity factor
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
CD83 PrEST Antigen
CD83 PrEST Antigen

Item number: ATA-APrEST95958.100

Atlas Antibodies
PrEST Antigen CD83, Gene description: CD83 molecule, Alternative Gene Names: BL11, HB15, Antigen sequence: KFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPQKTELV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May play a significant role in antigen presentation or the cellular...
Keywords: CD83, hCD83, CD83 antigen, B-cell activation protein, Cell surface protein HB15
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
LONRF2 PrEST Antigen
LONRF2 PrEST Antigen

Item number: ATA-APrEST95959.100

Atlas Antibodies
PrEST Antigen LONRF2, Gene description: LON peptidase N-terminal domain and ring finger 2, Alternative Gene Names: FLJ45273, RNF192, Antigen sequence: GHSHMNAQALLEEGDAGSSENSSEKSDMLGNTNSSVLYFILGLHFEEDKKALESILPTAPSAGLKRQFPDDVEDAPDLNAPGKIPKKDLSLQRSPN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw...
Keywords: RNF192, LONRF2, RING finger protein 192, Neuroblastoma apoptosis-related protease, LON peptidase N-terminal domain and...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
10872 from 10992 pages
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the usability of this website, serve for direct advertising or simplify interaction with other websites and social networks, will only be used with your consent. More information
Decline Accept all Configure