KCNA6 PrEST Antigen

PrEST Antigen KCNA6, Gene description: potassium voltage-gated channel subfamily A member 6, Alternative Gene Names: HBK2, Kv1.6, PPP1R96, Antigen sequence: EQGQYTHVTCGQPAPDLRATDNGLGKPDFPEANRERRPSYLPTPHRAYAE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Voltage-gated potassium channel that mediates transmembrane potassium transport in excitable membranes. Forms tetrameric potassium- selective channels through which potassium ions pass in accordance with their electrochemical gradient (PubMed:2347305, PubMed:14575698). The channel alternates between opened and closed conformations in response to the voltage difference across the membrane (PubMed:2347305, PubMed:14575698). Can form functional homotetrameric channels and heterotetrameric channels that contain variable proportions of KCNA1, KCNA2, KCNA4, KCNA6, and possibly other family members as well, channel properties depend on the type of alpha subunits that are part of the channel. Channel properties are modulated by cytoplasmic beta subunits that regulate the subcellular location of the alpha subunits and promote rapid inactivation. Homotetrameric channels display rapid activation and slow inactivation (PubMed:2347305). [The UniProt Consortium] Mouse gene identity: 92% Rat gene identity: 92%