LEMD1 PrEST Antigen

LEMD1 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95935.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen LEMD1, Gene description: LEM domain containing 1, Alternative Gene Names: CT50,... more
Product information "LEMD1 PrEST Antigen"
PrEST Antigen LEMD1, Gene description: LEM domain containing 1, Alternative Gene Names: CT50, LEMP-1, Antigen sequence: DVKCLSDCKLQNQLEKLGFSPGPILPSTRKLY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 75% Rat gene identity: 75%
Keywords: CT50, LEMD1, LEMP-1, LEM domain protein 1, Cancer/testis antigen 50, LEM domain-containing protein 1
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95935

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Database Information

UniProt ID : Q68G75 | Matching products
Gene ID : GeneID 93273 | Matching products

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "LEMD1 PrEST Antigen"
Write a review
or to review a product.
Viewed