RXRB PrEST Antigen

RXRB PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95947.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen RXRB, Gene description: retinoid X receptor beta, Alternative Gene Names: H-2RIIBP,... more
Product information "RXRB PrEST Antigen"
PrEST Antigen RXRB, Gene description: retinoid X receptor beta, Alternative Gene Names: H-2RIIBP, NR2B2, RCoR-1, RXR-beta, RXRbeta, Antigen sequence: MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR heterodimers bind to the retinoic acid response elements (RARE). [The UniProt Consortium] Mouse gene identity: 96% Rat gene identity: 96%
Keywords: RXRB, NR2B2, Retinoid X receptor beta, Retinoic acid receptor RXR-beta, Nuclear receptor subfamily 2 group B member 2
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95947

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "RXRB PrEST Antigen"
Write a review
or to review a product.
Viewed