N4BP2L1 PrEST Antigen

N4BP2L1 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95951.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen N4BP2L1, Gene description: NEDD4 binding protein 2 like 1, Alternative Gene Names:... more
Product information "N4BP2L1 PrEST Antigen"
PrEST Antigen N4BP2L1, Gene description: NEDD4 binding protein 2 like 1, Alternative Gene Names: CG018, Antigen sequence: SGKTTLARQLQHDFPRALIFSTDDFFFREDGAYEFNPDFLEEAHEWNQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 90% Rat gene identity: 90%
Keywords: CG081, N4BP2L1, NEDD4-binding protein 2-like 1
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95951

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Database Information

UniProt ID : Q5TBK1 | Matching products
Gene ID : GeneID 90634 | Matching products

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "N4BP2L1 PrEST Antigen"
Write a review
or to review a product.
Viewed