Anti-ACACB / Acetyl Coenzyme A Carboxylase 2

Item number Size Datasheet Manual SDS Delivery time Quantity Price
ARG42698.50 50 µg - -

6 - 14 business days*

551.00€
 
Protein function: Mitochondrial enzyme that catalyzes the carboxylation of acetyl-CoA to... more
Product information "Anti-ACACB / Acetyl Coenzyme A Carboxylase 2"
Protein function: Mitochondrial enzyme that catalyzes the carboxylation of acetyl-CoA to malonyl-CoA and plays a central role in fatty acid metabolism (PubMed:16854592, PubMed:19236960, PubMed:20457939, PubMed:20952656, PubMed:19900410, PubMed:26976583). Catalyzes a 2 steps reaction starting with the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain followed by the transfer of the carboxyl group from carboxylated biotin to acetyl-CoA (PubMed:19236960, PubMed:20457939, PubMed:20952656, PubMed:26976583). Through the production of malonyl-CoA that allosterically inhibits carnitine palmitoyltransferase 1 at the mitochondria, negatively regulates fatty acid oxidation. Together with its cytosolic isozyme ACACA, which is involved in de novo fatty acid biosynthesis, promotes lipid storage. [The UniProt Consortium]
Keywords: Anti-acetyl-ACC2, Anti-acetyl-ACC-beta, Anti-acetyl-Acetyl-CoA carboxylase 2
Supplier: Arigo Biolaboratories
Supplier-Nr: ARG42698

Properties

Application: FC, IHC (paraffin), WB
Antibody Type: Polyclonal
Conjugate: No
Host: Rabbit
Species reactivity: human, mouse, rat
Immunogen: Synthetic peptide corresponding to a sequence of Human ACACB / Acetyl Coenzyme A Carboxylase 2. (EENPEVAVDCVIYLSQHISPAERAQVVHLLSTMD)
MW: 277 kD
Format: Antigen Affinity Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-ACACB / Acetyl Coenzyme A Carboxylase 2"
Write a review
or to review a product.
Viewed