Anti-ZBTB7B (Zinc Finger and BTB Domain Containing 7B, DKFZp686G01254, THPOK, ZBTB15, ZFP67, ZNF857B

ZFP67 is an early growth response gene that encodes a zinc finger-containing transcription factor that binds to the promoter regions of type I collagen genes (e.g., COL1A1, MIM 120150) and has a role in development.[supplied by OMIM, Applications: Suitable for use in Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: HLCHRAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPSTMouse monoclonal antibody raised against a partial recombinant ZBTB7B.FPAGLDLSNGHLDTFRLSLARFWEQSAPTWAPVSTPGPPDDDEEEGAPTTPQAEGAME, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.