Anti-YY1, clone 2C10F9

Item number Size Datasheet Manual SDS Delivery time Quantity Price
NSJ-RQ7050 100 µg - -

3 - 10 business days*

790.00€
 
0.5mg/ml if reconstituted with 0.2ml sterile DI water. YY1 (Yin Yang 1) is a transcriptional... more
Product information "Anti-YY1, clone 2C10F9"
0.5mg/ml if reconstituted with 0.2ml sterile DI water. YY1 (Yin Yang 1) is a transcriptional repressor protein in humans that is encoded by the YY1 gene. YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1. Protein function: Multifunctional transcription factor that exhibits positive and negative control on a large number of cellular and viral genes by binding to sites overlapping the transcription start site (PubMed:15329343, PubMed:17721549, PubMed:24326773, PubMed:25787250). Binds to the consensus sequence 5'-CCGCCATNTT-3', some genes have been shown to contain a longer binding motif allowing enhanced binding, the initial CG dinucleotide can be methylated greatly reducing the binding affinity (PubMed:15329343, PubMed:17721549, PubMed:24326773, PubMed:25787250). The effect on transcription regulation is depending upon the context in which it binds and diverse mechanisms of action include direct activation or repression, indirect activation or repression via cofactor recruitment, or activation or repression by disruption of binding sites or conformational DNA changes (PubMed:15329343, PubMed:17721549, PubMed:24326773, PubMed:25787250). Its activity is regulated by transcription factors and cytoplasmic proteins that have been shown to abrogate or completely inhibit YY1- mediated activation or repression (PubMed:15329343, PubMed:17721549, PubMed:24326773, PubMed:25787250). For example, it acts as a repressor in absence of adenovirus E1A protein but as an activator in its presence (PubMed:1655281). Acts synergistically with the SMAD1 and SMAD4 in bone morphogenetic protein (BMP)-mediated cardiac-specific gene expression (PubMed:15329343). Binds to SMAD binding elements (SBEs) (5'-GTCT/AGAC-3') within BMP response element (BMPRE) of cardiac activating regions (PubMed:15329343). May play an important role in development and differentiation. Proposed to recruit the PRC2/EED-EZH2 complex to target genes that are transcriptional repressed (PubMed:11158321). Involved in DNA repair (PubMed:18026119, PubMed:28575647). In vitro, binds to DNA recombination intermediate structures (Holliday junctions). Plays a role in regulating enhancer activation (PubMed:28575647). [The UniProt Consortium]
Keywords: Anti-YY1, Anti-YY-1, Anti-NF-E1, Anti-INO80S, Anti-Yin and yang 1, Anti-INO80 complex subunit S, Anti-Delta transcription factor, Anti-Transcriptional repressor protein YY1, YY1 Antibody
Supplier: NSJ Bioreagents
Supplier-Nr: RQ7050

Properties

Application: WB, IHC (paraffin), FC
Antibody Type: Monoclonal
Clone: 2C10F9
Conjugate: No
Host: Mouse
Species reactivity: human, mouse, rat
Immunogen: Amino acids EQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEEQ
Format: Gene Regulation

Handling & Safety

Storage: +4°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Anti-YY1, clone 2C10F9"
Write a review
or to review a product.
Viewed